General Information

  • ID:  hor006365
  • Uniprot ID:  P01263
  • Protein name:  Calcitonin-1
  • Gene name:  NA
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007190 activation of adenylate cyclase activity; GO:0048240 sperm capacitation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
  • Length:  32(83-114)
  • Propeptide:  MVMMKLSALLIAYFLVICQMYSSHAAPARTGLESMTDQVTLTDYEARRLLNAIVKEFVQMTSEELEQQANEGNSLDRPMSKRCSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPGKKRSLPESNRYASYGDSYDGI
  • Signal peptide:  MVMMKLSALLIAYFLVICQMYSSHA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 13.18 minutes; /790.8 seconds ( PubMed ID: 18972837 )

Structure

  • Disulfide bond:  45664
  • Structure ID:  AF-P01263-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006365_AF2.pdbhor006365_ESM.pdb

Physical Information

Mass: 398800 Formula: C145H241N43O49S2
Absent amino acids: ADFIMW Common amino acids: LT
pI: 8.8 Basic residues: 4
Polar residues: 17 Hydrophobic residues: 6
Hydrophobicity: -53.75 Boman Index: -5442
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70
Instability Index: 1784.06 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  3691820
  • Title:  The structure of procalcitonin of the salmon as deduced from its cDNA sequence.
  • PubMed ID:  5261048
  • Title:  Amino acid sequence of salmon ultimobranchial calcitonin.
  • PubMed ID:  5361911
  • Title:  [Synthesis of salmon calcitonin, a high activity hypocalcemic hormone].
  • PubMed ID:  1991104
  • Title:  Two-dimensional NMR and structure determin
  • PubMed ID:  2043752
  • Title:  
  • PubMed ID:  1931969
  • Title:  
  • PubMed ID:  18972837
  • Title: