HORDB

ID: hor006365
Uniprot ID: P01263
Protein name: Calcitonin-1
Gene name: NA
Organism: Oncorhynchus keta (Chum salmon) (Salmo keta)
Family: Calcitonin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
GO BP: GO:0007165 signal transduction; GO:0007190 activation of adenylate cyclase activity; GO:0048240 sperm capacitation
GO CC: GO:0005576 extracellular region

Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Length: 32
Propeptide: MVMMKLSALLIAYFLVICQMYSSHAAPARTGLESMTDQVTLTDYEARRLLNAIVKEFVQMTSEELEQQANEGNSLDRPMSKRCSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPGKKRSLPESNRYASYGDSYDGI
Signal peptide: MVMMKLSALLIAYFLVICQMYSSHA
Modification: T32 Proline amide
Glycosylation: NA
Mutagenesis: NA

Function: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: 13.18 minutes; /790.8 seconds ( PubMed ID: 18972837 )

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006365_AF2.pdb

hor006365_ESM.pdb

Mass:	398800	Formula:	C145H241N43O49S2
Absent amino acids:	ADFIMW	Common amino acids:	LT
pI:	8.8	Basic residues:	4
Polar residues:	17	Hydrophobic residues:	6
Hydrophobicity:	-53.75	Boman Index:	-5442
Half-Life:	1.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	70
Instability Index:	1784.06	Extinction Coefficient cystines:	1615
Absorbance 280nm:	52.1

PubMed ID: 3691820
Title: The structure of procalcitonin of the salmon as deduced from its cDNA sequence.
PubMed ID: 5261048
Title: Amino acid sequence of salmon ultimobranchial calcitonin.
PubMed ID: 5361911
Title: [Synthesis of salmon calcitonin, a high activity hypocalcemic hormone].
PubMed ID: 1991104
Title: Two-dimensional NMR and structure determination of salmon calcitonin in methanol.
PubMed ID: 2043752
Title: Solution structure of salmon calcitonin.
PubMed ID: 1931969
Title: Solution conformation of salmon calcitonin in sodium dodecyl sulfate micelles as determined by two-dimensional NMR and distance geometry calculations.
PubMed ID: 18972837
Title: